SCOP 1.75: Domain d2fyuh1: 2fyu H:15-78

Lineage for d2fyuh1 (2fyu H:15-78)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)
   Uniprot P00126

8. Domain d2fyuh1: 2fyu H:15-78 [134402]
   Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyui1, d2fyuj1, d2fyuk1
   automatically matched to d1l0lh_
   complexed with fdn, fes, hem

Details for d2fyuh1

PDB Entry: 2fyu, 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor

PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOP Domain Sequences for d2fyuh1:

Sequence; same for both SEQRES and ATOM records:

>d2fyuh1 f.28.1.1 (H:15-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
nslk

Timeline for d2fyuh1:

• d2fyuh1 first appeared in SCOP 1.73
  
• d2fyuh1 is called d2fyuh_ in SCOPe 2.01
  
• d2fyuh1 appears in the current release, SCOPe 2.08, called d2fyuh_