Lineage for d2fyuh1 (2fyu H:15-78)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746390Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 746391Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 746392Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 746393Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 746405Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)
  8. 746412Domain d2fyuh1: 2fyu H:15-78 [134402]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyug1, d2fyui1, d2fyuj1
    automatically matched to d1l0lh_
    complexed with fdn, fes, hem

Details for d2fyuh1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOP Domain Sequences for d2fyuh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuh1 f.28.1.1 (H:15-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
nslk

SCOP Domain Coordinates for d2fyuh1:

Click to download the PDB-style file with coordinates for d2fyuh1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuh1: