Lineage for d2fyuf_ (2fyu F:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458053Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458054Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1458055Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1458085Protein automated matches [190325] (4 species)
    not a true protein
  7. 1458102Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)
  8. 1458105Domain d2fyuf_: 2fyu F: [134400]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_
    automated match to d1qcrf_
    complexed with fdn, fes, hem

Details for d2fyuf_

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (F:) Hypothetical protein LOC616871

SCOPe Domain Sequences for d2fyuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d2fyuf_:

Click to download the PDB-style file with coordinates for d2fyuf_.
(The format of our PDB-style files is described here.)

Timeline for d2fyuf_: