Lineage for d2fysb_ (2fys B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544153Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544205Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (41 PDB entries)
  8. 2544234Domain d2fysb_: 2fys B: [134390]
    automated match to d1erk__

Details for d2fysb_

PDB Entry: 2fys (more details), 2.5 Å

PDB Description: Crystal structure of Erk2 complex with KIM peptide derived from MKP3
PDB Compounds: (B:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d2fysb_:

Sequence, based on SEQRES records: (download)

>d2fysb_ d.144.1.7 (B:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyr

Sequence, based on observed residues (ATOM records): (download)

>d2fysb_ d.144.1.7 (B:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdeyvatrwyrape
imlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciin
lkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyy
dpsdepiaeapfklddlpkeklkelifeetarfqpgyr

SCOPe Domain Coordinates for d2fysb_:

Click to download the PDB-style file with coordinates for d2fysb_.
(The format of our PDB-style files is described here.)

Timeline for d2fysb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fysa_