Lineage for d2fysa1 (2fys A:8-356)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735276Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 735279Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (6 PDB entries)
  8. 735282Domain d2fysa1: 2fys A:8-356 [134389]
    automatically matched to d1erk__

Details for d2fysa1

PDB Entry: 2fys (more details), 2.5 Å

PDB Description: Crystal structure of Erk2 complex with KIM peptide derived from MKP3
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOP Domain Sequences for d2fysa1:

Sequence, based on SEQRES records: (download)

>d2fysa1 d.144.1.7 (A:8-356) MAP kinase Erk2 {Rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

Sequence, based on observed residues (ATOM records): (download)

>d2fysa1 d.144.1.7 (A:8-356) MAP kinase Erk2 {Rat (Rattus norvegicus) [TaxId: 10116]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnsgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

SCOP Domain Coordinates for d2fysa1:

Click to download the PDB-style file with coordinates for d2fysa1.
(The format of our PDB-style files is described here.)

Timeline for d2fysa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fysb1