Lineage for d2fymf2 (2fym F:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947666Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)
  8. 2947670Domain d2fymf2: 2fym F:1-139 [134386]
    Other proteins in same PDB: d2fyma1, d2fymc1, d2fymd1, d2fymf1
    automatically matched to d1e9ia2
    protein/RNA complex; complexed with mg

Details for d2fymf2

PDB Entry: 2fym (more details), 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.
PDB Compounds: (F:) enolase

SCOPe Domain Sequences for d2fymf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fymf2 d.54.1.1 (F:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOPe Domain Coordinates for d2fymf2:

Click to download the PDB-style file with coordinates for d2fymf2.
(The format of our PDB-style files is described here.)

Timeline for d2fymf2: