SCOP 1.75: Domain d2fyma2: 2fym A:1-139

Lineage for d2fyma2 (2fym A:1-139)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (8 species)

7. Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)

8. Domain d2fyma2: 2fym A:1-139 [134380]
   Other proteins in same PDB: d2fyma1, d2fymc1, d2fymd1, d2fymf1
   automatically matched to d1e9ia2
   complexed with mg

Details for d2fyma2

PDB Entry: 2fym, 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.

PDB Compounds: (A:) enolase

SCOP Domain Sequences for d2fyma2:

Sequence; same for both SEQRES and ATOM records:

>d2fyma2 d.54.1.1 (A:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

Timeline for d2fyma2:

• d2fyma2 first appeared in SCOP 1.73
  
• d2fyma2 appears in SCOPe 2.01
  
• d2fyma2 appears in the current release, SCOPe 2.08