Class a: All alpha proteins [46456] (258 folds) |
Fold a.13: RAP domain-like [47044] (1 superfamily) 3 helices, the first one is shorter than the other two; bundle, partly opened |
Superfamily a.13.1: RAP domain-like [47045] (1 family) |
Family a.13.1.1: RAP domain [47046] (1 protein) |
Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries) |
Domain d2fyla1: 2fyl A:17-97 [134378] automatically matched to d1op1a_ complexed with ca |
PDB Entry: 2fyl (more details)
SCOP Domain Sequences for d2fyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyla1 a.13.1.1 (A:17-97) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]} geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear lirnlnvilakygldgkkdar
Timeline for d2fyla1: