Lineage for d2fyla1 (2fyl A:17-97)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637204Fold a.13: RAP domain-like [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 637205Superfamily a.13.1: RAP domain-like [47045] (1 family) (S)
  5. 637206Family a.13.1.1: RAP domain [47046] (1 protein)
  6. 637207Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)
  7. 637208Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)
  8. 637215Domain d2fyla1: 2fyl A:17-97 [134378]
    automatically matched to d1op1a_
    complexed with ca

Details for d2fyla1

PDB Entry: 2fyl (more details)

PDB Description: haddock model of the complex between double module of lrp, cr56, and first domain of receptor associated protein, rap-d1.
PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein

SCOP Domain Sequences for d2fyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyla1 a.13.1.1 (A:17-97) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar

SCOP Domain Coordinates for d2fyla1:

Click to download the PDB-style file with coordinates for d2fyla1.
(The format of our PDB-style files is described here.)

Timeline for d2fyla1: