Lineage for d2fyka2 (2fyk A:1-188)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. Domain d2fyka2: 2fyk A:1-188 [134375]
    Other proteins in same PDB: d2fyka1, d2fykb1
    automated match to d1wnla2
    complexed with adp, btn

Details for d2fyka2

PDB Entry: 2fyk (more details), 1.6 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in complex with ADP and Biotin
PDB Compounds: (A:) biotin--protein ligase

SCOPe Domain Sequences for d2fyka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyka2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2fyka2 are not available.

Timeline for d2fyka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fyka1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fykb1, d2fykb2