![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein LysR-type regulatory protein Cbl [142816] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142817] (1 PDB entry) Uniprot Q47083 88-307 |
![]() | Domain d2fyid2: 2fyi D:88-307 [134373] Other proteins in same PDB: d2fyia2, d2fyib3, d2fyic3, d2fyid3 automated match to d2fyia1 |
PDB Entry: 2fyi (more details), 2.8 Å
SCOPe Domain Sequences for d2fyid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyid2 c.94.1.1 (D:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} tndtsgvltiatthtqaryslpevikafrelfpevrleliqgtpqeiatllqngeadigi aserlsndpqlvafpwfrwhhsllvphdhpltqispltlesiakwplityrqgitgrsri ddafarkglladivlsaqdsdviktyvalglgiglvaeqssgeqeeenlirldtrhlfda ntvwlglkrgqlqrnyvwrflelcnaglsvedikrqvmes
Timeline for d2fyid2: