SCOPe 2.08: Domain d2fyic2: 2fyi C:88-307

Lineage for d2fyic2 (2fyi C:88-307)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein LysR-type regulatory protein Cbl [142816] (1 species)

7. Species Escherichia coli [TaxId:562] [142817] (1 PDB entry)
   Uniprot Q47083 88-307

8. Domain d2fyic2: 2fyi C:88-307 [134372]
   Other proteins in same PDB: d2fyia2, d2fyib3, d2fyic3, d2fyid3
   automated match to d2fyia1

Details for d2fyic2

PDB Entry: 2fyi, 2.8 Å

PDB Description: Crystal Structure of the Cofactor-Binding Domain of the Cbl Transcriptional Regulator

PDB Compounds: (C:) HTH-type transcriptional regulator cbl

SCOPe Domain Sequences for d2fyic2:

Sequence; same for both SEQRES and ATOM records:

>d2fyic2 c.94.1.1 (C:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}
tndtsgvltiatthtqaryslpevikafrelfpevrleliqgtpqeiatllqngeadigi
aserlsndpqlvafpwfrwhhsllvphdhpltqispltlesiakwplityrqgitgrsri
ddafarkglladivlsaqdsdviktyvalglgiglvaeqssgeqeeenlirldtrhlfda
ntvwlglkrgqlqrnyvwrflelcnaglsvedikrqvmes

Timeline for d2fyic2:

• d2fyic2 first appeared in SCOP 1.73, called d2fyic1
  
• d2fyic2 appears in SCOPe 2.07