Lineage for d2fydd_ (2fyd D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1381405Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1381406Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1381415Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1381455Protein automated matches [190297] (2 species)
    not a true protein
  7. 1381456Species Cow (Bos taurus) [TaxId:9913] [187104] (2 PDB entries)
  8. 1381457Domain d2fydd_: 2fyd D: [134368]
    Other proteins in same PDB: d2fyda_, d2fydb1, d2fydc_
    automated match to d1o0rb_
    complexed with bgc, ca, mes, mn, nga, pg4, udp

Details for d2fydd_

PDB Entry: 2fyd (more details), 2 Å

PDB Description: catalytic domain of bovine beta 1, 4-galactosyltransferase in complex with alpha-lactalbumin, glucose, mn, and udp-n-acetylgalactosamine
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d2fydd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fydd_ c.68.1.2 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtcs

SCOPe Domain Coordinates for d2fydd_:

Click to download the PDB-style file with coordinates for d2fydd_.
(The format of our PDB-style files is described here.)

Timeline for d2fydd_: