Lineage for d2fydb1 (2fyd B:131-402)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133085Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 protein domains)
  6. 2133086Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 2133087Species Cow (Bos taurus) [TaxId:9913] [53454] (30 PDB entries)
    Uniprot P08037 131-402
  8. 2133095Domain d2fydb1: 2fyd B:131-402 [134366]
    Other proteins in same PDB: d2fyda_, d2fydc_, d2fydd_
    complexed with bgc, ca, mes, mn, nga, pg4, udp

Details for d2fydb1

PDB Entry: 2fyd (more details), 2 Å

PDB Description: catalytic domain of bovine beta 1, 4-galactosyltransferase in complex with alpha-lactalbumin, glucose, Mn, and UDP-N-acetylgalactosamine
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d2fydb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fydb1 c.68.1.2 (B:131-402) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ycgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtcs

SCOPe Domain Coordinates for d2fydb1:

Click to download the PDB-style file with coordinates for d2fydb1.
(The format of our PDB-style files is described here.)

Timeline for d2fydb1: