Lineage for d2fycd_ (2fyc D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898285Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2898345Protein automated matches [190297] (2 species)
    not a true protein
  7. 2898346Species Cow (Bos taurus) [TaxId:9913] [187104] (2 PDB entries)
  8. 2898347Domain d2fycd_: 2fyc D: [134364]
    Other proteins in same PDB: d2fyca_, d2fycb1, d2fycc_
    automated match to d1tvya_
    complexed with ca, gdu, mes, udp

Details for d2fycd_

PDB Entry: 2fyc (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d2fycd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fycd_ c.68.1.2 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d2fycd_:

Click to download the PDB-style file with coordinates for d2fycd_.
(The format of our PDB-style files is described here.)

Timeline for d2fycd_: