Lineage for d2fycc_ (2fyc C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2171157Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2171158Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2171190Species Mouse (Mus musculus) [TaxId:10090] [69628] (14 PDB entries)
  8. 2171200Domain d2fycc_: 2fyc C: [134363]
    Other proteins in same PDB: d2fycb1, d2fycd_
    automated match to d1nf5a_
    complexed with ca, gdu, mes, udp

Details for d2fycc_

PDB Entry: 2fyc (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d2fycc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fycc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d2fycc_:

Click to download the PDB-style file with coordinates for d2fycc_.
(The format of our PDB-style files is described here.)

Timeline for d2fycc_: