Lineage for d2fycb1 (2fyc B:131-402)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1614924Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1614925Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 1614926Species Cow (Bos taurus) [TaxId:9913] [53454] (20 PDB entries)
    Uniprot P08037 131-402
  8. 1614935Domain d2fycb1: 2fyc B:131-402 [134362]
    Other proteins in same PDB: d2fyca_, d2fycc_, d2fycd_
    complexed with ca, gdu, mes, udp

Details for d2fycb1

PDB Entry: 2fyc (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d2fycb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fycb1 c.68.1.2 (B:131-402) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigktrhirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d2fycb1:

Click to download the PDB-style file with coordinates for d2fycb1.
(The format of our PDB-style files is described here.)

Timeline for d2fycb1: