SCOPe 2.03: Domain d2fyca_: 2fyc A:

Lineage for d2fyca_ (2fyc A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)

8. Domain d2fyca_: 2fyc A: [134361]
   Other proteins in same PDB: d2fycb1, d2fycd_
   automated match to d1nf5a_
   complexed with ca, gdu, mes, udp

Details for d2fyca_

PDB Entry: 2fyc, 2 Å

PDB Description: crystal structure of the catalytic domain of bovine beta1,4- galactosyltransferase-i in complex with alpha-lactalbumin, ca and udp-galactose

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d2fyca_:

Sequence; same for both SEQRES and ATOM records:

>d2fyca_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d2fyca_:

• d2fyca_ first appeared in SCOP 1.73, called d2fyca1
  
• d2fyca_ appears in SCOPe 2.02
  
• d2fyca_ appears in SCOPe 2.04
  
• d2fyca_ appears in the current release, SCOPe 2.08