Lineage for d2fy8d2 (2fy8 D:245-336)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741399Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 741400Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family) (S)
  5. 741401Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 741408Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)
  7. 741409Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (2 PDB entries)
  8. 741413Domain d2fy8d2: 2fy8 D:245-336 [134352]
    Other proteins in same PDB: d2fy8a1, d2fy8b1, d2fy8c1, d2fy8d1, d2fy8e1, d2fy8f1, d2fy8g1, d2fy8h1
    automatically matched to d1lnqa4
    mutant

Details for d2fy8d2

PDB Entry: 2fy8 (more details), 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form
PDB Compounds: (D:) Calcium-gated potassium channel mthK

SCOP Domain Sequences for d2fy8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fy8d2 d.286.1.1 (D:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOP Domain Coordinates for d2fy8d2:

Click to download the PDB-style file with coordinates for d2fy8d2.
(The format of our PDB-style files is described here.)

Timeline for d2fy8d2: