Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily) beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold |
Superfamily d.286.1: TrkA C-terminal domain-like [116726] (1 family) |
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins) Pfam PF02080 |
Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species) |
Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (2 PDB entries) |
Domain d2fy8d2: 2fy8 D:245-336 [134352] Other proteins in same PDB: d2fy8a1, d2fy8b1, d2fy8c1, d2fy8d1, d2fy8e1, d2fy8f1, d2fy8g1, d2fy8h1 automatically matched to d1lnqa4 mutant |
PDB Entry: 2fy8 (more details), 2.79 Å
SCOP Domain Sequences for d2fy8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fy8d2 d.286.1.1 (D:245-336) Potassium channel-related protein MthK, C-terminal domain {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii dpprdysfragdiilgigkpeeierlknyisa
Timeline for d2fy8d2: