SCOPe 2.06: Domain d2fy6a1: 2fy6 A:33-175

Lineage for d2fy6a1 (2fy6 A:33-175)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (2 species)

7. Species Neisseria meningitidis serogroup A [TaxId:65699] [142386] (4 PDB entries)
   Uniprot Q9JWM8 33-175

8. Domain d2fy6a1: 2fy6 A:33-175 [134344]
   complexed with cl, so4

Details for d2fy6a1

PDB Entry: 2fy6, 1.9 Å

PDB Description: structure of the n-terminal domain of neisseria meningitidis pilb

PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA/msrB

SCOPe Domain Sequences for d2fy6a1:

Sequence; same for both SEQRES and ATOM records:

>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}
vphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanli
tvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdvq
rivkgsineaqalalirdpnadl

Timeline for d2fy6a1:

• d2fy6a1 first appeared in SCOP 1.73
  
• d2fy6a1 appears in SCOPe 2.05
  
• d2fy6a1 appears in SCOPe 2.07
  
• d2fy6a1 appears in the current release, SCOPe 2.08