Lineage for d2fxva_ (2fxv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2143902Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2144244Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 2144245Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
    Uniprot P42085 1-191
  8. 2144250Domain d2fxva_: 2fxv A: [134342]
    automated match to d1y0ba1
    complexed with 5gp, gol

Details for d2fxva_

PDB Entry: 2fxv (more details), 2.05 Å

PDB Description: Bacillus subtilis Xanthine Phosphoribosyltransferase in Complex with Guanosine 5'-monophosphate (GMP)
PDB Compounds: (A:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d2fxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxva_ c.61.1.1 (A:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvq

SCOPe Domain Coordinates for d2fxva_:

Click to download the PDB-style file with coordinates for d2fxva_.
(The format of our PDB-style files is described here.)

Timeline for d2fxva_: