Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Xanthine phosphoribosyltransferase [142556] (1 species) |
Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries) Uniprot P42085 1-191 |
Domain d2fxva_: 2fxv A: [134342] automated match to d1y0ba1 complexed with 5gp, gol |
PDB Entry: 2fxv (more details), 2.05 Å
SCOPe Domain Sequences for d2fxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxva_ c.61.1.1 (A:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs leegkvsfvq
Timeline for d2fxva_: