Lineage for d2fxva1 (2fxv A:1-190)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704217Protein Xanthine phosphoribosyltransferase [142556] (1 species)
  7. 704218Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
  8. 704223Domain d2fxva1: 2fxv A:1-190 [134342]
    automatically matched to 1Y0B A:1-191
    complexed with 5gp, gol

Details for d2fxva1

PDB Entry: 2fxv (more details), 2.05 Å

PDB Description: Bacillus subtilis Xanthine Phosphoribosyltransferase in Complex with Guanosine 5'-monophosphate (GMP)
PDB Compounds: (A:) Xanthine phosphoribosyltransferase

SCOP Domain Sequences for d2fxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxva1 c.61.1.1 (A:1-190) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvq

SCOP Domain Coordinates for d2fxva1:

Click to download the PDB-style file with coordinates for d2fxva1.
(The format of our PDB-style files is described here.)

Timeline for d2fxva1: