SCOPe 2.08: Domain d2fxva_: 2fxv A:

Lineage for d2fxva_ (2fxv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Xanthine phosphoribosyltransferase [142556] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142557] (2 PDB entries)
   Uniprot P42085 1-191

8. Domain d2fxva_: 2fxv A: [134342]
   automated match to d1y0ba1
   complexed with 5gp, gol

Details for d2fxva_

PDB Entry: 2fxv, 2.05 Å

PDB Description: Bacillus subtilis Xanthine Phosphoribosyltransferase in Complex with Guanosine 5'-monophosphate (GMP)

PDB Compounds: (A:) Xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d2fxva_:

Sequence; same for both SEQRES and ATOM records:

>d2fxva_ c.61.1.1 (A:) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]}
mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiess
giapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhv
liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
leegkvsfvq

Timeline for d2fxva_:

• d2fxva_ first appeared in SCOP 1.73, called d2fxva1
  
• d2fxva_ appears in SCOPe 2.07