SCOPe 2.04: Domain d2fxra_: 2fxr A:

Lineage for d2fxra_ (2fxr A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (13 PDB entries)

8. Domain d2fxra_: 2fxr A: [134335]
   automated match to d1a0la_
   complexed with c3a

Details for d2fxra_

PDB Entry: 2fxr, 2.5 Å

PDB Description: human beta tryptase ii complexed with activated ketone inhibitor cra- 29382

PDB Compounds: (A:) Tryptase beta-2

SCOPe Domain Sequences for d2fxra_:

Sequence; same for both SEQRES and ATOM records:

>d2fxra_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2fxra_:

• d2fxra_ first appeared in SCOP 1.73, called d2fxra1
  
• d2fxra_ appears in SCOPe 2.03
  
• d2fxra_ appears in SCOPe 2.05
  
• d2fxra_ appears in the current release, SCOPe 2.08