Lineage for d2fxra1 (2fxr A:16-244)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802341Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 802342Species Human (Homo sapiens) [TaxId:9606] [50547] (9 PDB entries)
  8. 802371Domain d2fxra1: 2fxr A:16-244 [134335]
    automatically matched to d1a0la_
    complexed with c3a

Details for d2fxra1

PDB Entry: 2fxr (more details), 2.5 Å

PDB Description: human beta tryptase ii complexed with activated ketone inhibitor cra- 29382
PDB Compounds: (A:) Tryptase beta-2

SCOP Domain Sequences for d2fxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxra1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOP Domain Coordinates for d2fxra1:

Click to download the PDB-style file with coordinates for d2fxra1.
(The format of our PDB-style files is described here.)

Timeline for d2fxra1: