SCOP 1.73: Domain d2fxpc1: 2fxp C:2-55

Lineage for d2fxpc1 (2fxp C:2-55)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)

8. Domain d2fxpc1: 2fxp C:2-55 [134334]
   automatically matched to 2FXP A:2-55

Details for d2fxpc1

PDB Entry: 2fxp

PDB Description: solution structure of the sars-coronavirus hr2 domain

PDB Compounds: (C:) Spike glycoprotein

SCOP Domain Sequences for d2fxpc1:

Sequence; same for both SEQRES and ATOM records:

>d2fxpc1 h.3.3.1 (C:2-55) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
shtspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik

Timeline for d2fxpc1:

• d2fxpc1 is new in SCOP 1.73
  
• d2fxpc1 appears in SCOP 1.75
  
• d2fxpc1 appears in the current release, SCOPe 2.08, called d2fxpc2