SCOPe 2.08: Domain d2fxpc2: 2fxp C:3-55

Lineage for d2fxpc2 (2fxp C:3-55)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families)

5. Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein)

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
   Uniprot P59594 896-972,1142-1183
   Uniprot Q6UZF0 914-949,1148-1193

8. Domain d2fxpc2: 2fxp C:3-55 [134334]
   Other proteins in same PDB: d2fxpa2, d2fxpb3, d2fxpc3
   automated match to d2fxpa1

Details for d2fxpc2

PDB Entry: 2fxp

PDB Description: solution structure of the sars-coronavirus hr2 domain

PDB Compounds: (C:) Spike glycoprotein

SCOPe Domain Sequences for d2fxpc2:

Sequence; same for both SEQRES and ATOM records:

>d2fxpc2 h.3.3.1 (C:3-55) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
htspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik

Timeline for d2fxpc2:

• d2fxpc2 first appeared in SCOP 1.73, called d2fxpc1
  
• d2fxpc2 appears in SCOPe 2.07