Lineage for d2fxpb2 (2fxp B:3-55)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042207Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families) (S)
  5. 3042208Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein)
  6. 3042209Protein E2 spike glycoprotein [111476] (2 species)
  7. 3042210Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
    Uniprot P59594 896-972,1142-1183
    Uniprot Q6UZF0 914-949,1148-1193
  8. 3042236Domain d2fxpb2: 2fxp B:3-55 [134333]
    Other proteins in same PDB: d2fxpa2, d2fxpb3, d2fxpc3
    automated match to d2fxpa1

Details for d2fxpb2

PDB Entry: 2fxp (more details)

PDB Description: solution structure of the sars-coronavirus hr2 domain
PDB Compounds: (B:) Spike glycoprotein

SCOPe Domain Sequences for d2fxpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxpb2 h.3.3.1 (B:3-55) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
htspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik

SCOPe Domain Coordinates for d2fxpb2:

Click to download the PDB-style file with coordinates for d2fxpb2.
(The format of our PDB-style files is described here.)

Timeline for d2fxpb2: