| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families) ![]() |
| Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein) |
| Protein E2 spike glycoprotein [111476] (2 species) |
| Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries) Uniprot P59594 896-972,1142-1183 Uniprot Q6UZF0 914-949,1148-1193 |
| Domain d2fxpa1: 2fxp A:3-55 [134332] Other proteins in same PDB: d2fxpa2, d2fxpb3, d2fxpc3 |
PDB Entry: 2fxp (more details)
SCOPe Domain Sequences for d2fxpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxpa1 h.3.3.1 (A:3-55) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
htspdvdlgdisginasvvniqkeidrlnevaknlneslidlqelgkyeqyik
Timeline for d2fxpa1:
View in 3DDomains from other chains: (mouse over for more information) d2fxpb2, d2fxpb3, d2fxpc2, d2fxpc3 |