Lineage for d2fxoc2 (2fxo C:838-962)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645121Superfamily h.1.26: Myosin rod fragments [90257] (2 families) (S)
  5. 2645122Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 2645123Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species)
  7. 2645124Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)
    Uniprot P12883 838-963
  8. 2645127Domain d2fxoc2: 2fxo C:838-962 [134330]
    Other proteins in same PDB: d2fxoa2, d2fxob3, d2fxoc3, d2fxod3
    automated match to d2fxoa1

Details for d2fxoc2

PDB Entry: 2fxo (more details), 2.5 Å

PDB Description: structure of the human beta-myosin s2 fragment
PDB Compounds: (C:) Myosin heavy chain, cardiac muscle beta isoform

SCOPe Domain Sequences for d2fxoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxoc2 h.1.26.1 (C:838-962) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnkrledeeemnaeltakkrkledecselkrdiddl
eltla

SCOPe Domain Coordinates for d2fxoc2:

Click to download the PDB-style file with coordinates for d2fxoc2.
(The format of our PDB-style files is described here.)

Timeline for d2fxoc2: