![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.26: Myosin rod fragments [90257] (2 families) ![]() |
![]() | Family h.1.26.1: Myosin rod fragments [90258] (2 proteins) |
![]() | Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries) Uniprot P12883 838-963 |
![]() | Domain d2fxoc2: 2fxo C:838-962 [134330] Other proteins in same PDB: d2fxoa2, d2fxob3, d2fxoc3, d2fxod3 automated match to d2fxoa1 |
PDB Entry: 2fxo (more details), 2.5 Å
SCOPe Domain Sequences for d2fxoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxoc2 h.1.26.1 (C:838-962) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]} pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn ladaeercdqliknkiqleakvkemnkrledeeemnaeltakkrkledecselkrdiddl eltla
Timeline for d2fxoc2: