SCOPe 2.06: Domain d2fxob2: 2fxo B:838-961

Lineage for d2fxob2 (2fxo B:838-961)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (2 families)

5. Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)

6. Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)
   Uniprot P12883 838-963

8. Domain d2fxob2: 2fxo B:838-961 [134329]
   Other proteins in same PDB: d2fxoa2, d2fxob3, d2fxoc3, d2fxod3
   automated match to d2fxoa1

Details for d2fxob2

PDB Entry: 2fxo, 2.5 Å

PDB Description: structure of the human beta-myosin s2 fragment

PDB Compounds: (B:) Myosin heavy chain, cardiac muscle beta isoform

SCOPe Domain Sequences for d2fxob2:

Sequence; same for both SEQRES and ATOM records:

>d2fxob2 h.1.26.1 (B:838-961) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnkrledeeemnaeltakkrkledecselkrdiddl
eltl

Timeline for d2fxob2:

• d2fxob2 first appeared in SCOP 1.73, called d2fxob1
  
• d2fxob2 was called d2fxob_ in SCOPe 2.05
  
• d2fxob2 appears in SCOPe 2.07
  
• d2fxob2 appears in the current release, SCOPe 2.08