SCOP 1.73: Domain d2fxob1: 2fxo B:838-961

Lineage for d2fxob1 (2fxo B:838-961)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.26: Myosin rod fragments [90257] (1 family)

5. Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)

6. Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)

8. Domain d2fxob1: 2fxo B:838-961 [134329]
   automatically matched to 2FXO A:838-963

Details for d2fxob1

PDB Entry: 2fxo, 2.5 Å

PDB Description: structure of the human beta-myosin s2 fragment

PDB Compounds: (B:) Myosin heavy chain, cardiac muscle beta isoform

SCOP Domain Sequences for d2fxob1:

Sequence; same for both SEQRES and ATOM records:

>d2fxob1 h.1.26.1 (B:838-961) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnkrledeeemnaeltakkrkledecselkrdiddl
eltl

Timeline for d2fxob1:

• d2fxob1 is new in SCOP 1.73
  
• d2fxob1 appears in SCOP 1.75
  
• d2fxob1 appears in the current release, SCOPe 2.08, called d2fxob2