SCOPe 2.06: Domain d2fxoa1: 2fxo A:838-963

Lineage for d2fxoa1 (2fxo A:838-963)

Root: SCOPe 2.06
Class h: Coiled coil proteins [57942] (7 folds)
Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.26: Myosin rod fragments [90257] (2 families)
Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)
Uniprot P12883 838-963
Domain d2fxoa1: 2fxo A:838-963 [134328]
Other proteins in same PDB: d2fxoa2, d2fxob3, d2fxoc3, d2fxod3

Details for d2fxoa1

PDB Entry: 2fxo (more details), 2.5 Å

PDB Description: structure of the human beta-myosin s2 fragment

PDB Compounds: (A:) Myosin heavy chain, cardiac muscle beta isoform

SCOPe Domain Sequences for d2fxoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxoa1 h.1.26.1 (A:838-963) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnkrledeeemnaeltakkrkledecselkrdiddl
eltlak

SCOPe Domain Coordinates for d2fxoa1:

Click to download the PDB-style file with coordinates for d2fxoa1.
(The format of our PDB-style files is described here.)

Timeline for d2fxoa1: