Lineage for d2fxma1 (2fxm A:838-963)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645121Superfamily h.1.26: Myosin rod fragments [90257] (2 families) (S)
  5. 2645122Family h.1.26.1: Myosin rod fragments [90258] (2 proteins)
  6. 2645123Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species)
  7. 2645124Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)
    Uniprot P12883 838-963
  8. 2645129Domain d2fxma1: 2fxm A:838-963 [134327]
    complexed with hg

Details for d2fxma1

PDB Entry: 2fxm (more details), 2.7 Å

PDB Description: structure of the human beta-myosin s2 fragment
PDB Compounds: (A:) Myosin heavy chain, cardiac muscle beta isoform

SCOPe Domain Sequences for d2fxma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxma1 h.1.26.1 (A:838-963) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnerledeeemnaeltakkrkledecselkrdiddl
eltlak

SCOPe Domain Coordinates for d2fxma1:

Click to download the PDB-style file with coordinates for d2fxma1.
(The format of our PDB-style files is described here.)

Timeline for d2fxma1: