Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.26: Myosin rod fragments [90257] (2 families) |
Family h.1.26.1: Myosin rod fragments [90258] (2 proteins) |
Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries) Uniprot P12883 838-963 |
Domain d2fxma1: 2fxm A:838-963 [134327] complexed with hg |
PDB Entry: 2fxm (more details), 2.7 Å
SCOPe Domain Sequences for d2fxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxma1 h.1.26.1 (A:838-963) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]} pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn ladaeercdqliknkiqleakvkemnerledeeemnaeltakkrkledecselkrdiddl eltlak
Timeline for d2fxma1: