Lineage for d2fxla2 (2fxl A:137-295)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)
  8. Domain d2fxla2: 2fxl A:137-295 [134326]
    automated match to d1r4ua2
    complexed with 2al

Details for d2fxla2

PDB Entry: 2fxl (more details), 1.7600000000000002 Å

PDB Description: urate oxidase from aspergillus flavus complexed with allantoin
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d2fxla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxla2 d.96.1.4 (A:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

SCOPe Domain Coordinates for d2fxla2 are not available.

Timeline for d2fxla2:

Domains from same chain:
(mouse over for more information)
d2fxla1