SCOPe 2.04: Domain d2fxjb2: 2fxj B:444-748

Lineage for d2fxjb2 (2fxj B:444-748)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
   Uniprot P13029 Q939D2 35-748

8. Domain d2fxjb2: 2fxj B:444-748 [134322]
   automated match to d2ccaa2
   complexed with hem, mpd, na, trs

Details for d2fxjb2

PDB Entry: 2fxj, 1.95 Å

PDB Description: crystal structure of katg at ph 8.5

PDB Compounds: (B:) catalase-peroxidase protein

SCOPe Domain Sequences for d2fxjb2:

Sequence; same for both SEQRES and ATOM records:

>d2fxjb2 a.93.1.3 (B:444-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

Timeline for d2fxjb2:

• d2fxjb2 first appeared in SCOP 1.73
  
• d2fxjb2 appears in SCOPe 2.03
  
• d2fxjb2 appears in SCOPe 2.05
  
• d2fxjb2 last appears in SCOPe 2.06