Class a: All alpha proteins [46456] (286 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins) duplication: tandem repeat of two CCP-like domains |
Protein Catalase-peroxidase KatG [74754] (4 species) only the N-terminal CCP-like domain binds heme |
Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries) Uniprot P13029 Q939D2 35-748 |
Domain d2fxjb1: 2fxj B:35-443 [134321] automated match to d1sj2a1 complexed with hem, mpd, na, trs |
PDB Entry: 2fxj (more details), 1.95 Å
SCOPe Domain Sequences for d2fxjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxjb1 a.93.1.3 (B:35-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev
Timeline for d2fxjb1: