SCOPe 2.06: Domain d2fxia_: 2fxi A:

Lineage for d2fxia_ (2fxi A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Arsenate reductase ArsC [69504] (3 species)
   also has a phosphotyrosine phosphatase activity

7. Species Staphylococcus aureus [TaxId:1280] [69505] (8 PDB entries)
   Uniprot P30330

8. Domain d2fxia_: 2fxi A: [134318]
   automated match to d1jfva_
   complexed with k, so4; mutant

Details for d2fxia_

PDB Entry: 2fxi, 1.8 Å

PDB Description: arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site

PDB Compounds: (A:) protein arsc

SCOPe Domain Sequences for d2fxia_:

Sequence; same for both SEQRES and ATOM records:

>d2fxia_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]}
mdkktiyfistgnsarsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidis
nhtsdlidndilkqsdlvvtlcsdadnncpilppnvkkehwgfddpagkewsefqrvrde
iklaiekfklr

Timeline for d2fxia_:

• d2fxia_ first appeared in SCOP 1.73, called d2fxia1
  
• d2fxia_ appears in SCOPe 2.05
  
• d2fxia_ appears in SCOPe 2.07
  
• d2fxia_ appears in the current release, SCOPe 2.08