Lineage for d2fxha1 (2fxh A:35-440)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773578Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 773579Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 773585Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 773594Domain d2fxha1: 2fxh A:35-440 [134314]
    automatically matched to d1mwva1
    complexed with hem, mpd, na, trs

Details for d2fxha1

PDB Entry: 2fxh (more details), 1.9 Å

PDB Description: crystal structure of katg at ph 6.5
PDB Compounds: (A:) catalase-peroxidase protein

SCOP Domain Sequences for d2fxha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxha1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOP Domain Coordinates for d2fxha1:

Click to download the PDB-style file with coordinates for d2fxha1.
(The format of our PDB-style files is described here.)

Timeline for d2fxha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fxha2