SCOPe 2.02: Domain d2fxga2: 2fxg A:441-748

Lineage for d2fxga2 (2fxg A:441-748)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:28450] [89093] (14 PDB entries)
   Uniprot P13029 Q939D2 35-748

8. Domain d2fxga2: 2fxg A:441-748 [134311]
   automatically matched to d1mwva2
   complexed with hem, na

Details for d2fxga2

PDB Entry: 2fxg, 2 Å

PDB Description: crystal structure of katg at ph 4.5

PDB Compounds: (A:) catalase-peroxidase protein

SCOPe Domain Sequences for d2fxga2:

Sequence; same for both SEQRES and ATOM records:

>d2fxga2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

Timeline for d2fxga2:

• d2fxga2 first appeared in SCOP 1.73
  
• d2fxga2 appears in SCOPe 2.01
  
• d2fxga2 appears in SCOPe 2.03
  
• d2fxga2 last appears in SCOPe 2.06