Lineage for d2fxfb_ (2fxf B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209250Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. 2209251Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries)
    Uniprot P21673 2-170! Uniprot P21673 3-169
  8. 2209256Domain d2fxfb_: 2fxf B: [134309]
    automated match to d2b3ua1
    complexed with aco, act, ca

Details for d2fxfb_

PDB Entry: 2fxf (more details), 2 Å

PDB Description: human spermidine/spermine n1-acetyltransferase
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2fxfb_:

Sequence, based on SEQRES records: (download)

>d2fxfb_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

Sequence, based on observed residues (ATOM records): (download)

>d2fxfb_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeyqviltekdlledgfgehpfyhclvaevpkehw
tpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcss
mhflvaewnepsinfykrrgasdlegwrlfkidkeyllkmatee

SCOPe Domain Coordinates for d2fxfb_:

Click to download the PDB-style file with coordinates for d2fxfb_.
(The format of our PDB-style files is described here.)

Timeline for d2fxfb_: