Lineage for d2fxad1 (2fxa D:7-167)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635444Family a.4.5.28: MarR-like transcriptional regulators [63379] (16 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 635487Protein Protease production regulatory protein Hpr [140251] (1 species)
  7. 635488Species Bacillus subtilis [TaxId:1423] [140252] (1 PDB entry)
  8. 635492Domain d2fxad1: 2fxa D:7-167 [134307]
    automatically matched to 2FXA A:6-167
    complexed with 1pe, edo, p6g, pge

Details for d2fxad1

PDB Entry: 2fxa (more details), 2.4 Å

PDB Description: structure of the protease production regulatory protein hpr from bacillus subtilis.
PDB Compounds: (D:) Protease production regulatory protein hpr

SCOP Domain Sequences for d2fxad1:

Sequence, based on SEQRES records: (download)

>d2fxad1 a.4.5.28 (D:7-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
pydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasisei
akfgvmhvstafnfskkleergylrfskrlndkrntyvqlteegtevfwslleefdptrn
avfkgsqplyhlfgkfpevaemmcmirhiygddfmeifets

Sequence, based on observed residues (ATOM records): (download)

>d2fxad1 a.4.5.28 (D:7-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
pydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasisei
akfgvmhvstafnfskkleergylrfsktyvqlteegtevfwslleefdptrnavfkgsq
plyhlfgkfpevaemmcmirhiygddfmeifets

SCOP Domain Coordinates for d2fxad1:

Click to download the PDB-style file with coordinates for d2fxad1.
(The format of our PDB-style files is described here.)

Timeline for d2fxad1: