Lineage for d2fxac_ (2fxa C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693763Protein Protease production regulatory protein Hpr [140251] (1 species)
  7. 2693764Species Bacillus subtilis [TaxId:1423] [140252] (1 PDB entry)
    Uniprot P11065 6-167
  8. 2693767Domain d2fxac_: 2fxa C: [134306]
    automated match to d2fxaa1
    complexed with 1pe, edo, p6g, pge

Details for d2fxac_

PDB Entry: 2fxa (more details), 2.4 Å

PDB Description: structure of the protease production regulatory protein hpr from bacillus subtilis.
PDB Compounds: (C:) Protease production regulatory protein hpr

SCOPe Domain Sequences for d2fxac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fxac_ a.4.5.28 (C:) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
ydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasiseia
kfgvmhvstafnfskkleergylrfskrlndkrntyvqlteegtevfwslleefdptrna
vfkgsqplyhlfgkfpevaemmcmirhiygddfmeifets

SCOPe Domain Coordinates for d2fxac_:

Click to download the PDB-style file with coordinates for d2fxac_.
(The format of our PDB-style files is described here.)

Timeline for d2fxac_: