SCOPe 2.08: Domain d2fxab_: 2fxa B:

Lineage for d2fxab_ (2fxa B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Protease production regulatory protein Hpr [140251] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140252] (1 PDB entry)
   Uniprot P11065 6-167

8. Domain d2fxab_: 2fxa B: [134305]
   automated match to d2fxaa1
   complexed with 1pe, edo, p6g, pge

Details for d2fxab_

PDB Entry: 2fxa, 2.4 Å

PDB Description: structure of the protease production regulatory protein hpr from bacillus subtilis.

PDB Compounds: (B:) Protease production regulatory protein hpr

SCOPe Domain Sequences for d2fxab_:

Sequence; same for both SEQRES and ATOM records:

>d2fxab_ a.4.5.28 (B:) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
ydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasiseia
kfgvmhvstafnfskkleergylrfskrlndkrntyvqlteegtevfwslleefdptrna
vfkgsqplyhlfgkfpevaemmcmirhiygddfmeifetsltnidndfesvngklkkkak

Timeline for d2fxab_:

• d2fxab_ first appeared in SCOP 1.73, called d2fxab1
  
• d2fxab_ appears in SCOPe 2.07