Lineage for d2fxaa1 (2fxa A:6-167)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982915Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1982962Protein Protease production regulatory protein Hpr [140251] (1 species)
  7. 1982963Species Bacillus subtilis [TaxId:1423] [140252] (1 PDB entry)
    Uniprot P11065 6-167
  8. 1982964Domain d2fxaa1: 2fxa A:6-167 [134304]
    complexed with 1pe, edo, p6g, pge

Details for d2fxaa1

PDB Entry: 2fxa (more details), 2.4 Å

PDB Description: structure of the protease production regulatory protein hpr from bacillus subtilis.
PDB Compounds: (A:) Protease production regulatory protein hpr

SCOPe Domain Sequences for d2fxaa1:

Sequence, based on SEQRES records: (download)

>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
ppydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasise
iakfgvmhvstafnfskkleergylrfskrlndkrntyvqlteegtevfwslleefdptr
navfkgsqplyhlfgkfpevaemmcmirhiygddfmeifets

Sequence, based on observed residues (ATOM records): (download)

>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
ppydvkealvftqkmaqlskalwksiekdwqqwlkpydlninehhilwiayqlngasise
iakfgvmhvstafnfskkleergylrfskrtyvqlteegtevfwslleefdptrnavfkg
sqplyhlfgkfpevaemmcmirhiygddfmeifets

SCOPe Domain Coordinates for d2fxaa1:

Click to download the PDB-style file with coordinates for d2fxaa1.
(The format of our PDB-style files is described here.)

Timeline for d2fxaa1: