SCOP 1.73: Domain d2fx9i2: 2fx9 I:114-227

Lineage for d2fx9i2 (2fx9 I:114-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2fx9i2: 2fx9 I:114-227 [134299]
   Other proteins in same PDB: d2fx9h1, d2fx9i1, d2fx9l1, d2fx9l2, d2fx9m1, d2fx9m2
   automatically matched to d1ngzb2
   complexed with orq

Details for d2fx9i2

PDB Entry: 2fx9, 2.1 Å

PDB Description: Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a thioether-linked peptide encompassing the 4e10 epitope on gp41

PDB Compounds: (I:) Fab 4E10

SCOP Domain Sequences for d2fx9i2:

Sequence; same for both SEQRES and ATOM records:

>d2fx9i2 b.1.1.2 (I:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2fx9i2:

• d2fx9i2 appears in SCOP 1.75
  
• d2fx9i2 appears in the current release, SCOPe 2.07