Lineage for d2fx8n1 (2fx8 N:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288752Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 1288773Domain d2fx8n1: 2fx8 N:1-107 [134292]
    Other proteins in same PDB: d2fx8h1, d2fx8h2, d2fx8i1, d2fx8i2, d2fx8j1, d2fx8j2, d2fx8k1, d2fx8k2, d2fx8l2, d2fx8m2, d2fx8n2, d2fx8o2
    automatically matched to d1rhha1

Details for d2fx8n1

PDB Entry: 2fx8 (more details), 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41
PDB Compounds: (N:) Fab 4E10

SCOPe Domain Sequences for d2fx8n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx8n1 b.1.1.1 (N:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk

SCOPe Domain Coordinates for d2fx8n1:

Click to download the PDB-style file with coordinates for d2fx8n1.
(The format of our PDB-style files is described here.)

Timeline for d2fx8n1: