Lineage for d2fx8m2 (2fx8 M:108-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516385Domain d2fx8m2: 2fx8 M:108-213 [134291]
    Other proteins in same PDB: d2fx8h1, d2fx8h2, d2fx8i1, d2fx8i2, d2fx8j1, d2fx8j2, d2fx8k1, d2fx8k2, d2fx8l1, d2fx8m1, d2fx8n1, d2fx8o1
    automatically matched to d1rhha2

Details for d2fx8m2

PDB Entry: 2fx8 (more details), 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41
PDB Compounds: (M:) Fab 4E10

SCOPe Domain Sequences for d2fx8m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx8m2 b.1.1.2 (M:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d2fx8m2:

Click to download the PDB-style file with coordinates for d2fx8m2.
(The format of our PDB-style files is described here.)

Timeline for d2fx8m2: